Recombinant Human PPP2R1A, His-tagged
Cat.No. : | PPP2R1A-27571TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 280-583 of Human PPP2R1A with N terminal His tag, 304 amino acids, 35kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 280-583 a.a. |
Description : | This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A. Alternatively spliced transcript variants have been described. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 96 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRE NVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILG KDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVI GIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQ LGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKF GKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEV CGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGP ILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL |
Gene Name | PPP2R1A protein phosphatase 2, regulatory subunit A, alpha [ Homo sapiens ] |
Official Symbol | PPP2R1A |
Synonyms | PPP2R1A; protein phosphatase 2, regulatory subunit A, alpha; protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform , protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform; serine/threonine-protein phosphatase |
Gene ID | 5518 |
mRNA Refseq | NM_014225 |
Protein Refseq | NP_055040 |
MIM | 605983 |
Uniprot ID | P30153 |
Chromosome Location | 19q13 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; |
Function | antigen binding; protein binding; protein heterodimerization activity; protein phosphatase type 2A regulator activity; protein serine/threonine phosphatase activity; |
◆ Recombinant Proteins | ||
PPP2R1A-5688H | Recombinant Human PPP2R1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PPP2R1A-27571TH | Recombinant Human PPP2R1A, His-tagged | +Inquiry |
Ppp2r1a-6778M | Recombinant Full Length Mouse Ppp2r1a Protein (Met1-Ala589), C-His tagged | +Inquiry |
PPP2R1A-49H | Recombinant Human PPP2R1A Protein, Full Length, N-GST tagged | +Inquiry |
PPP2R1A-7031M | Recombinant Mouse PPP2R1A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2R1A-2926HCL | Recombinant Human PPP2R1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP2R1A Products
Required fields are marked with *
My Review for All PPP2R1A Products
Required fields are marked with *
0
Inquiry Basket