Recombinant Human PPP1R8 Protein (1-209 aa), GST-tagged

• Cat.No.: PPP1R8-2143H
• Product Overview: Recombinant Human PPP1R8 Protein (1-209 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Isoform 2.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-209 aa
• Description: Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation. Isoform Gamma is a site-specific single-strand endoribonuclease that cleaves single strand RNA 3' to purines and pyrimidines in A+U-rich regions. It generates 5'-phosphate termini at the site of cleavage. This isoform does not inhibit PP-1. May be implicated in mRNA splicing.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 52.1 kDa
• AA Sequence: MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLILENGTHMASSDACHECKSMIAAAG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: PPP1R8 protein phosphatase 1, regulatory subunit 8 [ Homo sapiens ]
• Official Symbol: PPP1R8
• Synonyms: PPP1R8; ard 1; ARD1; NIPP 1; NIPP1; PRO2047; RNase E; RD-1; NIPP-1
• Gene ID: 5511
• mRNA Refseq: NM_002713
• Protein Refseq: NP_002704
• MIM: 602636
• UniProt ID: Q12972