Recombinant Human PPP1R8

• Cat.No.: PPP1R8-26964TH
• Product Overview: Recombinant fragment of Human NIPP1, Isoform Gamma with N-terminal proprietary tag. Predicted MW 36.63kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Ubiquitously expressed, with highest levels in heart and skeletal muscle, followed by brain, placenta, lung, liver and pancreas. Less abundant in kidney. The concentration and ratio between isoforms is cell-type dependent. Isoform Alpha (>90%) and isoform
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
• Sequence Similarities: Contains 1 FHA domain.

Gene Information

• Gene Name: PPP1R8 protein phosphatase 1, regulatory subunit 8 [ Homo sapiens ]
• Official Symbol: PPP1R8
• Synonyms: PPP1R8; protein phosphatase 1, regulatory subunit 8; protein phosphatase 1, regulatory (inhibitor) subunit 8; nuclear inhibitor of protein phosphatase 1; activator of RNA decay; ard 1; ARD1; NIPP 1; NIPP1; nuclear subunit of PP 1; PRO2047; protein phospha
• Gene ID: 5511
• mRNA Refseq: NM_002713
• Protein Refseq: NP_002704
• MIM: 602636
• Uniprot ID: Q12972
• Chromosome Location: 1p35.3
• Function: DNA binding; RNA binding; endonuclease activity; hydrolase activity; protein binding