Recombinant Human PPIL3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PPIL3-6101H |
Product Overview : | PPIL3 MS Standard C13 and N15-labeled recombinant protein (NP_570981) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 18.2 kDa |
AA Sequence : | MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNEVHIKDITIHANPFAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PPIL3 peptidylprolyl isomerase like 3 [ Homo sapiens (human) ] |
Official Symbol | PPIL3 |
Synonyms | PPIL3; peptidylprolyl isomerase (cyclophilin)-like 3; peptidyl-prolyl cis-trans isomerase-like 3; Cyclophilin J; CyPJ; PPIase; cyclophilin J; rotamase PPIL3; PPIase-like protein 3; cyclophilin-like protein 3; cyclophilin-like protein PPIL3; peptidylprolyl cis-trans isomerase-like protein 3; CYPJ; |
Gene ID | 53938 |
mRNA Refseq | NM_130906 |
Protein Refseq | NP_570981 |
MIM | 615811 |
UniProt ID | Q9H2H8 |
◆ Recombinant Proteins | ||
PPIL3-30678TH | Recombinant Human PPIL3, His-tagged | +Inquiry |
PPIL3-6101H | Recombinant Human PPIL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PPIL3-714H | Recombinant Human PPIL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PPIL3-2491H | Active Recombinant Human Peptidylprolyl Isomerase (cyclophilin)-Like 3, His-tagged | +Inquiry |
PPIL3-3368R | Recombinant Rhesus Macaque PPIL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIL3-2966HCL | Recombinant Human PPIL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPIL3 Products
Required fields are marked with *
My Review for All PPIL3 Products
Required fields are marked with *
0
Inquiry Basket