Recombinant Human PPIL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PPIL3-714H
• Product Overview: PPIL3 MS Standard C13 and N15-labeled recombinant protein (NP_572028) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 18.2 kDa
• AA Sequence: MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNEVHIKDITIHANPFAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PPIL3 peptidylprolyl isomerase like 3 [ Homo sapiens (human) ]
• Official Symbol: PPIL3
• Synonyms: PPIL3; peptidylprolyl isomerase (cyclophilin)-like 3; peptidyl-prolyl cis-trans isomerase-like 3; Cyclophilin J; CyPJ; PPIase; cyclophilin J; rotamase PPIL3; PPIase-like protein 3; cyclophilin-like protein 3; cyclophilin-like protein PPIL3; peptidylprolyl cis-trans isomerase-like protein 3; CYPJ
• Gene ID: 53938
• mRNA Refseq: NM_131916
• Protein Refseq: NP_572028
• MIM: 615811
• UniProt ID: Q9H2H8