Recombinant Human PPIL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PPIL3-714H
Product Overview : PPIL3 MS Standard C13 and N15-labeled recombinant protein (NP_572028) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants.
Molecular Mass : 18.2 kDa
AA Sequence : MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNEVHIKDITIHANPFAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PPIL3 peptidylprolyl isomerase like 3 [ Homo sapiens (human) ]
Official Symbol PPIL3
Synonyms PPIL3; peptidylprolyl isomerase (cyclophilin)-like 3; peptidyl-prolyl cis-trans isomerase-like 3; Cyclophilin J; CyPJ; PPIase; cyclophilin J; rotamase PPIL3; PPIase-like protein 3; cyclophilin-like protein 3; cyclophilin-like protein PPIL3; peptidylprolyl cis-trans isomerase-like protein 3; CYPJ;
Gene ID 53938
mRNA Refseq NM_131916
Protein Refseq NP_572028
MIM 615811
UniProt ID Q9H2H8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPIL3 Products

Required fields are marked with *

My Review for All PPIL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon