Recombinant Human PPIL1, His-tagged

Cat.No. : PPIL1-29971TH
Product Overview : Recombinant full length human PPIL1, fused to His tag at C terminus; 174 amino acids, 19.3 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Conjugation : HIS
Source : E. coli
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFA ELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGK QFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQ WLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKII KAYPSGLEHHHHHH
Full Length : Full L.
Gene Name PPIL1 peptidylprolyl isomerase (cyclophilin)-like 1 [ Homo sapiens ]
Official Symbol PPIL1
Synonyms PPIL1; peptidylprolyl isomerase (cyclophilin)-like 1; peptidyl-prolyl cis-trans isomerase-like 1; CYPL1;
Gene ID 51645
mRNA Refseq NM_016059
Protein Refseq NP_057143
MIM 601301
Uniprot ID Q9Y3C6
Chromosome Location 6p21.1
Pathway Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem;
Function isomerase activity; peptidyl-prolyl cis-trans isomerase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPIL1 Products

Required fields are marked with *

My Review for All PPIL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon