Recombinant Human PPIL1, His-tagged
Cat.No. : | PPIL1-29971TH |
Product Overview : | Recombinant full length human PPIL1, fused to His tag at C terminus; 174 amino acids, 19.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. |
Conjugation : | HIS |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFA ELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGK QFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQ WLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKII KAYPSGLEHHHHHH |
Full Length : | Full L. |
Gene Name | PPIL1 peptidylprolyl isomerase (cyclophilin)-like 1 [ Homo sapiens ] |
Official Symbol | PPIL1 |
Synonyms | PPIL1; peptidylprolyl isomerase (cyclophilin)-like 1; peptidyl-prolyl cis-trans isomerase-like 1; CYPL1; |
Gene ID | 51645 |
mRNA Refseq | NM_016059 |
Protein Refseq | NP_057143 |
MIM | 601301 |
Uniprot ID | Q9Y3C6 |
Chromosome Location | 6p21.1 |
Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; |
Function | isomerase activity; peptidyl-prolyl cis-trans isomerase activity; |
◆ Recombinant Proteins | ||
PPIL1-8641H | Recombinant Human PPIL1 protein, His-tagged | +Inquiry |
PPIL1-177H | Recombinant Human PPIL1 protein, T7-tagged | +Inquiry |
PPIL1-29971TH | Recombinant Human PPIL1, His-tagged | +Inquiry |
PPIL1-333H | Recombinant Human Peptidylprolyl Isomerase (Cyclophilin)-Like 1, His-tagged | +Inquiry |
PPIL1-1753H | Recombinant Human Peptidylprolyl Isomerase (cyclophilin)-Like 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIL1-2968HCL | Recombinant Human PPIL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPIL1 Products
Required fields are marked with *
My Review for All PPIL1 Products
Required fields are marked with *
0
Inquiry Basket