Recombinant Human PPIL1 protein, T7-tagged
Cat.No. : | PPIL1-177H |
Product Overview : | Recombinant human PPIL1 (166 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 166 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFGSMAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIK DFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVC QGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro SKIP related spliceosome regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PPIL1 protein–protein interaction assay development.4. May be used as antigen for specific antibody development. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | PPIL1 peptidylprolyl isomerase (cyclophilin)-like 1 [ Homo sapiens ] |
Official Symbol | PPIL1 |
Synonyms | PPIL1; peptidylprolyl isomerase (cyclophilin)-like 1; peptidyl-prolyl cis-trans isomerase-like 1; CYPL1; rotamase PPIL1; cyclophilin-related gene 1; peptidyl-prolyl cis-trans isomerase; hCyPX; PPIase; CGI-124; MGC678; |
Gene ID | 51645 |
mRNA Refseq | NM_016059 |
Protein Refseq | NP_057143 |
MIM | 601301 |
UniProt ID | Q9Y3C6 |
Chromosome Location | 6p21.1 |
Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; |
Function | isomerase activity; peptidyl-prolyl cis-trans isomerase activity; |
◆ Recombinant Proteins | ||
PPIL1-410H | Recombinant Human PPIL1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
PPIL1-8641H | Recombinant Human PPIL1 protein, His-tagged | +Inquiry |
PPIL1-1753H | Recombinant Human Peptidylprolyl Isomerase (cyclophilin)-Like 1 | +Inquiry |
PPIL1-333H | Recombinant Human Peptidylprolyl Isomerase (Cyclophilin)-Like 1, His-tagged | +Inquiry |
PPIL1-3435Z | Recombinant Zebrafish PPIL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIL1-2968HCL | Recombinant Human PPIL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPIL1 Products
Required fields are marked with *
My Review for All PPIL1 Products
Required fields are marked with *
0
Inquiry Basket