Recombinant Human PPIF protein, T7-tagged

• Cat.No.: PPIF-159H
• Product Overview: Recombinant human PPIF (207 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 207 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGEFMLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLG RVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHV GPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro mitochondrial mediated cell apoptosis regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PPIF protein-protein interaction.4. May be used as antigen for specific antibody development.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: PPIF peptidylprolyl isomerase F [ Homo sapiens ]
• Official Symbol: PPIF
• Synonyms: PPIF; cyclophilin D; Cyp D; hCyP3; PPIase F; rotamase F; cyclophilin 3; cyclophilin F; CYP3; Cyp-D; FLJ90798; MGC117207
• Gene ID: 10105
• mRNA Refseq: NM_005729
• Protein Refseq: NP_005720
• MIM: 604486
• UniProt ID: P30405
• Chromosome Location: 10q22-q23
• Pathway: Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Parkinsons disease, organism-specific biosystem; Toxoplasmosis, organism-specific biosystem; Toxoplasmosis, conserved biosystem
• Function: cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity