Recombinant Human PPIF protein, T7-tagged
Cat.No. : | PPIF-159H |
Product Overview : | Recombinant human PPIF (207 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 207 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFMLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLG RVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHV GPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro mitochondrial mediated cell apoptosis regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PPIF protein-protein interaction.4. May be used as antigen for specific antibody development. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | PPIF peptidylprolyl isomerase F [ Homo sapiens ] |
Official Symbol | PPIF |
Synonyms | PPIF; cyclophilin D; Cyp D; hCyP3; PPIase F; rotamase F; cyclophilin 3; cyclophilin F; CYP3; Cyp-D; FLJ90798; MGC117207; |
Gene ID | 10105 |
mRNA Refseq | NM_005729 |
Protein Refseq | NP_005720 |
MIM | 604486 |
UniProt ID | P30405 |
Chromosome Location | 10q22-q23 |
Pathway | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Parkinsons disease, organism-specific biosystem; Toxoplasmosis, organism-specific biosystem; Toxoplasmosis, conserved biosystem; |
Function | cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; |
◆ Recombinant Proteins | ||
Ppif-284M | Recombinant Mouse Ppif Protein, MYC/DDK-tagged | +Inquiry |
PPIF-0851H | Recombinant Human PPIF Protein (S43-S207), His tagged | +Inquiry |
PPIF-3365R | Recombinant Rhesus Macaque PPIF Protein, His (Fc)-Avi-tagged | +Inquiry |
PPIF-159H | Recombinant Human PPIF protein, T7-tagged | +Inquiry |
Ppif-109R | Recombinant Rat Ppif, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIF-2970HCL | Recombinant Human PPIF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPIF Products
Required fields are marked with *
My Review for All PPIF Products
Required fields are marked with *
0
Inquiry Basket