Recombinant Human PPIE protein, His-tagged
| Cat.No. : | PPIE-3418H |
| Product Overview : | Recombinant Human PPIE protein(1-301 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-301 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PPIE peptidylprolyl isomerase E (cyclophilin E) [ Homo sapiens ] |
| Official Symbol | PPIE |
| Synonyms | PPIE; peptidylprolyl isomerase E (cyclophilin E); peptidyl-prolyl cis-trans isomerase E; cyclophilin 33; cyclophilin E; CyP 33; MGC3736; MGC111222; peptidyl prolyl cis trans isomerase E; peptidylprolyl isomerase E; isoform 1; PPIase E; rotamase E; cyclophilin-33; CYP33; CYP-33; |
| Gene ID | 10450 |
| mRNA Refseq | NM_001195007 |
| Protein Refseq | NP_001181936 |
| MIM | 602435 |
| UniProt ID | Q9UNP9 |
| ◆ Recombinant Proteins | ||
| Ppie-7041M | Recombinant Mouse Ppie protein, His & T7-tagged | +Inquiry |
| PPIE-118H | Recombinant Human Peptidylprolyl isomerase E isoform 1, His-tagged | +Inquiry |
| PPIE-5539H | Recombinant Human PPIE Protein (Tyr41-Val264), N-His tagged | +Inquiry |
| PPIE-3418H | Recombinant Human PPIE protein, His-tagged | +Inquiry |
| PPIE-1885H | Recombinant Human PPIE, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPIE-2971HCL | Recombinant Human PPIE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPIE Products
Required fields are marked with *
My Review for All PPIE Products
Required fields are marked with *
