Recombinant Human PPAP2B, GST-tagged

Description :	The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells.
Source :	Wheat germ
Species :	Human
Tag :	GST
Molecular Mass :	59.95 kDa
AA Sequence :	MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKY PLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVS IGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARL LRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKMTLSLPAPAIRKEILSPVD IIDRNNHHNMM
Applications :	ELISA; WB-Re; AP; Array
Storage :	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	PPAP2B phosphatidic acid phosphatase type 2B [ Homo sapiens ]
Official Symbol	PPAP2B
Synonyms	PPAP2B; LPP3; VCIP; Dri42; PAP2B; phosphatidic acid phosphatase type 2B; lipid phosphate phosphohydrolase 3; PAP2 beta; phosphatidate phosphohydrolase type 2b; type-2 phosphatidic acid phosphatase-beta; vascular endothelial growth factor and type I collagen inducible; NP_003704.3; EC 3.1.3.4
Gene ID	8613
mRNA Refseq	NM_003713
Protein Refseq	NP_003704
MIM	607125
UniProt ID	O14495
Chromosome Location	1p32.2
Pathway	Ether lipid metabolism; Fat digestion and absorption; Fc gamma R-mediated phagocytosis
Function	integrin binding; lipid phosphatase activity; phosphatidate phosphatase activity