Recombinant Human PPA1 Protein, Flag-tagged
| Cat.No. : | PPA1-22H |
| Product Overview : | Recombinant Human PPA1 Protein is produced by HEK293T expression system. This protein is fused with a Flag tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Flag |
| Form : | PBS buffer |
| Molecular Mass : | 33 kDa |
| AA Sequence : | MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | PPA1 pyrophosphatase (inorganic) 1 [ Homo sapiens ] |
| Official Symbol | PPA1 |
| Synonyms | PPA1; IOPPP; PP1; Ppase; PPase; pyrophosphatase 1; PP; SID6-8061; MGC111556; |
| Gene ID | 5464 |
| mRNA Refseq | NM_021129 |
| Protein Refseq | NP_066952 |
| MIM | 179030 |
| UniProt ID | Q15181 |
| ◆ Recombinant Proteins | ||
| PPA1-22H | Recombinant Human PPA1 Protein, Flag-tagged | +Inquiry |
| PPA1-5998H | Recombinant Human PPA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PPA1-1397H | Recombinant Human Pyrophosphatase (inorganic) 1, His-tagged | +Inquiry |
| PPA1-0913H | Recombinant Human PPA1 protein(228-289aa), His-tagged | +Inquiry |
| PPA1-3442H | Recombinant Human PPA1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPA1-2995HCL | Recombinant Human PPA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPA1 Products
Required fields are marked with *
My Review for All PPA1 Products
Required fields are marked with *
0
Inquiry Basket
