Recombinant Human PPA1 Protein, Flag-tagged
Cat.No. : | PPA1-22H |
Product Overview : | Recombinant Human PPA1 Protein is produced by HEK293T expression system. This protein is fused with a Flag tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Form : | PBS buffer |
Molecular Mass : | 33 kDa |
AA Sequence : | MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | PPA1 pyrophosphatase (inorganic) 1 [ Homo sapiens ] |
Official Symbol | PPA1 |
Synonyms | PPA1; IOPPP; PP1; Ppase; PPase; pyrophosphatase 1; PP; SID6-8061; MGC111556; |
Gene ID | 5464 |
mRNA Refseq | NM_021129 |
Protein Refseq | NP_066952 |
MIM | 179030 |
UniProt ID | Q15181 |
◆ Recombinant Proteins | ||
S100A14-3723H | Recombinant Human S100A14 protein, His-tagged | +Inquiry |
ASMT-428R | Recombinant Rhesus monkey ASMT Protein, His-tagged | +Inquiry |
CLMP-2689H | Recombinant Human CLMP Protein, His (Fc)-Avi-tagged | +Inquiry |
TFPT-9156M | Recombinant Mouse TFPT Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL8467NF | Recombinant Full Length Neisseria Meningitidis Serogroup B Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgA-247G | Native Guinea Pig Immunoglobulin A | +Inquiry |
APOA2-608H | Native Human Apolipoprotein A-II | +Inquiry |
ALB-5362B | Native Bovine Albumin | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
IgA-244H | Native Horse Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHDH-347HCL | Recombinant Human CHDH cell lysate | +Inquiry |
MAP3K2-4506HCL | Recombinant Human MAP3K2 293 Cell Lysate | +Inquiry |
LARP6-971HCL | Recombinant Human LARP6 cell lysate | +Inquiry |
TMCC1-1028HCL | Recombinant Human TMCC1 293 Cell Lysate | +Inquiry |
ADCK5-11HCL | Recombinant Human ADCK5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPA1 Products
Required fields are marked with *
My Review for All PPA1 Products
Required fields are marked with *
0
Inquiry Basket