Recombinant Human POLR2J3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : POLR2J3-5216H
Product Overview : POLR2J3 MS Standard C13 and N15-labeled recombinant protein (NP_001091084) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of the RNA polymerase II subunit 11 gene family, which includes three genes in a cluster on chromosome 7q22.1 and a pseudogene on chromosome 7p13. The founding member of this family, DNA directed RNA polymerase II polypeptide J, has been shown to encode a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This locus produces multiple, alternatively spliced transcripts that potentially express isoforms with distinct C-termini compared to DNA directed RNA polymerase II polypeptide J. Most or all variants are spliced to include additional non-coding exons at the 3' end which makes them candidates for nonsense-mediated decay (NMD). Consequently, it is not known if this locus expresses a protein or proteins in vivo.
Molecular Mass : 12.9 kDa
AA Sequence : MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name POLR2J3 RNA polymerase II subunit J3 [ Homo sapiens (human) ]
Official Symbol POLR2J3
Synonyms POLR2J3; polymerase (RNA) II (DNA directed) polypeptide J3; POLR2J2; RPB11b1; RPB11b2; DNA-directed RNA polymerase II subunit RPB11-b2; RNA polymerase II subunit B11-b2; DNA-directed RNA polymerase II subunit 11; DNA-directed RNA polymerase II subunit J3
Gene ID 548644
mRNA Refseq NM_001097615
Protein Refseq NP_001091084
UniProt ID Q9GZM3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All POLR2J3 Products

Required fields are marked with *

My Review for All POLR2J3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon