Recombinant Human POLK, His-tagged

Cat.No. : POLK-838H
Product Overview : Recombinant Human POLK, fused with His tag C-Terminus, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
ProteinLength : 1 to 560
Description : External and internal DNA-damaging agents continually threaten the integrity of genetic material in cells. Although a variety of repair mechanisms exist to remove the resulting lesions, some lesions escape repair and block the replication machinery. Members of the Y family of DNA polymerases, such as POLK, permit the continuity of the replication fork by allowing replication through such DNA lesions. Each Y family polymerase has a unique DNA-damage bypass and fidelity profile. POLK is specialized for the extension step of lesion bypass.
Form : Liquid
Molecular Mass : 64 kDa
AA Sequence : MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAKELLKTEIDADF PHPLRLRLMGVRISSFPNEEDRKHQQRSIIGFLQAGNQALSATECTLEKT DKDKFVKPLE
Purity : >90% by SDS-PAGE.
Applications : ELISA; SDS-PAGE; Western blot; Functional Studies
Storage : Store at -20°C or -80°C.
Concentration : 3.2 mg/ml
Gene Name POLK?polymerase (DNA directed) kappa [?Homo sapiens?(human) ]
Official Symbol POLK
Synonyms POLK; DINP; POLQ; DINB1; polymerase (DNA directed) kappa; DNA polymerase kappa; NP_057302.1; EC 2.7.7.7
Gene ID 51426
mRNA Refseq NM_016218
Protein Refseq NP_057302
MIM 605650
UniProt ID Q9UBT6
Chromosome Location 5q13
Pathway Fanconi anemia pathway
Function DNA-directed DNA polymerase activity; damaged DNA binding; metal ion binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All POLK Products

Required fields are marked with *

My Review for All POLK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon