Recombinant Human POLK, GST-tagged
Cat.No. : | POLK-765H |
Product Overview : | Human POLK full-length ORF ( AAH50718, 1 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | External and internal DNA-damaging agents continually threaten the integrity of genetic material in cells. Although a variety of repair mechanisms exist to remove the resulting lesions, some lesions escape repair and block the replication machinery. Members of the Y family of DNA polymerases, such as POLK, permit the continuity of the replication fork by allowing replication through such DNA lesions. Each Y family polymerase has a unique DNA-damage bypass and fidelity profile. POLK is specialized for the extension step of lesion bypass. |
Molecular Mass : | 77.66 kDa |
AA Sequence : | MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQIT SQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRA AMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKM GSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFR IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTE LYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKER LKVLYFDMVSLVFKFFNSKMLP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | POLK polymerase (DNA directed) kappa [ Homo sapiens (human) ] |
Official Symbol | POLK |
Synonyms | POLK; DINP; POLQ; DINB1; polymerase (DNA directed) kappa; DNA polymerase kappa; EC 2.7.7.7 |
Gene ID | 51426 |
mRNA Refseq | NM_016218 |
Protein Refseq | NP_057302 |
MIM | 605650 |
UniProt ID | Q9UBT6 |
Chromosome Location | 5q13 |
Pathway | Fanconi anemia pathway |
Function | DNA-directed DNA polymerase activity; damaged DNA binding; metal ion binding |
◆ Recombinant Proteins | ||
SHOC2-2664H | Recombinant Human SHOC2 protein, GST-tagged | +Inquiry |
LSM6-309Z | Recombinant Zebrafish LSM6 | +Inquiry |
OTUD6B-1491C | Recombinant Chicken OTUD6B | +Inquiry |
KRAS-01H | Recombinant Human KRAS G12D mutant Protein, DYKDDDDK-tagged | +Inquiry |
RFL23681BF | Recombinant Full Length Bufo Bufo Rhodopsin(Rho) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1864W | Active Native Succinylated Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
Tnnt2-7425M | Native Mouse Tnnt2 Protein | +Inquiry |
TPSAB1-02H | Active Native Human TPSAB1 Protein | +Inquiry |
IgG-05T | Native Toxoplasma gondii IgG antigen, RH strain | +Inquiry |
IGHG3-231H | Native Human Immunoglobulin G3 (IgG3) | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK8-4489HCL | Recombinant Human MAPK8 293 Cell Lysate | +Inquiry |
Cerebrum-134R | Rat Cerebrum Tissue Lysate | +Inquiry |
TRAM1-1818HCL | Recombinant Human TRAM1 cell lysate | +Inquiry |
UPK1A-723HCL | Recombinant Human UPK1A lysate | +Inquiry |
PRKRA-2848HCL | Recombinant Human PRKRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All POLK Products
Required fields are marked with *
My Review for All POLK Products
Required fields are marked with *
0
Inquiry Basket