Recombinant Human POLK, GST-tagged

Cat.No. : POLK-765H
Product Overview : Human POLK full-length ORF ( AAH50718, 1 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : External and internal DNA-damaging agents continually threaten the integrity of genetic material in cells. Although a variety of repair mechanisms exist to remove the resulting lesions, some lesions escape repair and block the replication machinery. Members of the Y family of DNA polymerases, such as POLK, permit the continuity of the replication fork by allowing replication through such DNA lesions. Each Y family polymerase has a unique DNA-damage bypass and fidelity profile. POLK is specialized for the extension step of lesion bypass.
Molecular Mass : 77.66 kDa
AA Sequence : MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQIT SQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTSNYHARRFGVRA AMPGFIAKRLCPQLIIVPPNFDKYRAVSKEVKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKM GSSVENDNPGKEVNKLSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFR IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTE LYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKER LKVLYFDMVSLVFKFFNSKMLP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name POLK polymerase (DNA directed) kappa [ Homo sapiens (human) ]
Official Symbol POLK
Synonyms POLK; DINP; POLQ; DINB1; polymerase (DNA directed) kappa; DNA polymerase kappa; EC 2.7.7.7
Gene ID 51426
mRNA Refseq NM_016218
Protein Refseq NP_057302
MIM 605650
UniProt ID Q9UBT6
Chromosome Location 5q13
Pathway Fanconi anemia pathway
Function DNA-directed DNA polymerase activity; damaged DNA binding; metal ion binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All POLK Products

Required fields are marked with *

My Review for All POLK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon