Recombinant Human POFUT2 protein, GST-tagged

• Cat.No.: POFUT2-285H
• Product Overview: Recombinant Human POFUT2(1 a.a. - 429 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-429 a.a.
• Description: Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (EGF; MIM 131530)-like repeats or thrombospondin (THBS; see MIM 188060) type-1 repeats. POFUT2 is an O-fucosyltransferase that use THBS type-1 repeats as substrates (Luo et al., 2006 [PubMed 16464857]).
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 76.4 kDa
• AA Sequence: MATLSFVFLLLGAVSWPPASASGQEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLK TEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEG TWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNTSARSVMLDRAENLLH DHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIW GHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAIIDQWIC AHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKITY
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: POFUT2 protein O-fucosyltransferase 2 [ Homo sapiens ]
• Official Symbol: POFUT2
• Synonyms: POFUT2; protein O-fucosyltransferase 2; C21orf80, chromosome 21 open reading frame 80; GDP-fucose protein O-fucosyltransferase 2; FUT13; KIAA0958; O-FucT-2; peptide-O-fucosyltransferase 2; C21orf80
• Gene ID: 23275
• mRNA Refseq: NM_133635
• Protein Refseq: NP_598368
• MIM: 610249
• UniProt ID: Q9Y2G5
• Chromosome Location: 21q22.3
• Pathway: Other types of O-glycan biosynthesis, organism-specific biosystem; Other types of O-glycan biosynthesis, conserved biosystem
• Function: peptide-O-fucosyltransferase activity; transferase activity, transferring glycosyl groups