Recombinant Human POFUT2, His-tagged

• Cat.No.: POFUT2-27511TH
• Product Overview: Recombinant fragment, corresponding to amino acids 196-429 of Human POFUT2 with N terminal His tag; Predicted MWt 28 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 196-429 a.a.
• Description: Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (EGF; MIM 131530)-like repeats or thrombospondin (THBS; see MIM 188060) type-1 repeats. POFUT2 is an O-fucosyltransferase that use THBS type-1 repeats as substrates (Luo et al.
• Conjugation: HIS
• Tissue specificity: Isoform A is expressed in fetal liver and peripheral blood lymphocytes. Isoform B is expressed in spleen, lung, testis, bone marrow, thymus, pancreas, prostate, fetal brain, fetal liver and fetal kidney. Isoform C is expressed in brain, heart, spleen, liv
• Form: Lyophilised:Reconstitute with 133 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWD TRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDW MKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEG AVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEM VRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTF SFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKI TY
• Sequence Similarities: Belongs to the glycosyltransferase 68 family.

Gene Information

• Gene Name: POFUT2 protein O-fucosyltransferase 2 [ Homo sapiens ]
• Official Symbol: POFUT2
• Synonyms: POFUT2; protein O-fucosyltransferase 2; C21orf80, chromosome 21 open reading frame 80; GDP-fucose protein O-fucosyltransferase 2; FUT13; KIAA0958
• Gene ID: 23275
• mRNA Refseq: NM_015227
• Protein Refseq: NP_056042
• MIM: 610249
• Uniprot ID: Q9Y2G5
• Chromosome Location: 21q22.3
• Pathway: Other types of O-glycan biosynthesis, organism-specific biosystem; Other types of O-glycan biosynthesis, conserved biosystem
• Function: peptide-O-fucosyltransferase activity; transferase activity, transferring glycosyl groups