Recombinant Human PNPLA3 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: PNPLA3-091H
• Product Overview: PNPLA3 MS Standard C13 and N15-labeled recombinant protein (NP_079501) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes.
• Molecular Mass: 52.8 kDa
• AA Sequence: MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGIPLEQTLQVLSDLVRKARSRNIGIFHPSFNLSKFLRQGLGKCLPANVHQLISGKIGISLTRVSDGENVLVSDFRSKDEVVDALVCSCFMPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRIMSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCTPEQDWPCWTPCSPEGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PNPLA3 patatin like phospholipase domain containing 3 [ Homo sapiens (human) ]
• Official Symbol: PNPLA3
• Synonyms: PNPLA3; patatin like phospholipase domain containing 3; ADPN; C22orf20; iPLA(2)epsilon; 1-acylglycerol-3-phosphate O-acyltransferase PNPLA3; acylglycerol O-acyltransferase; acylglycerol transacylase; adiponutrin; calcium-independent phospholipase A2-epsilon; iPLA2-epsilon; iPLA2epsilon; lysophosphatidic acid acyltransferase; patatin-like phospholipase domain-containing protein 3; EC 2.3.1.51; EC 3.1.1.3
• Gene ID: 80339
• mRNA Refseq: NM_025225
• Protein Refseq: NP_079501
• MIM: 609567
• UniProt ID: Q9NST1