Recombinant Human PISD protein, GST-tagged

• Cat.No.: PISD-15H
• Product Overview: Recombinant Human PISD(1 a.a. - 409 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1-409 a.a.
• Description: Phosphatidylserine decarboxylases (PSDs; EC 4.1.1.65) catalyze the formation of phosphatidylethanolamine (PE) by decarboxylation of phosphatidylserine (PS). Type I PSDs, such as PISD, are targeted to the inner mitochondrial membrane by an N-terminal targeting sequence. PISD also contains a conserved LGST motif that functions as an autocatalytic cleavage site where the proenzyme is split into mature alpha and beta subunits (Schuiki and Daum, 2009 [PubMed 19165886]).
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 71.39 kDa
• AA Sequence: MATSVGHRCLGLLHGVAPWRSSLHPCEITALSQSLQPLRKLPFRAFRTDARKIHTAPARTMFLLRPLPILLVTGG GYAGYRQYEKYRERELEKLGLEIPPKLAGHWEVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVN MKEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHSVISPSDGRILNFGQVKNCEVEQVKGVTYSLESFLGPRMCT EDLPFPPAASCDSFKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKELFC HNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNREGVPMRKGEHLGEFN LGSTIVLIFEAPKDFNFQLKTGQKIRFGEALGSL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: PISD phosphatidylserine decarboxylase [ Homo sapiens ]
• Official Symbol: PISD
• Synonyms: PISD; phosphatidylserine decarboxylase; phosphatidylserine decarboxylase proenzyme; dJ858B16.2; PSDC; PSD; PSSC; DJ858B16; DKFZp566G2246
• Gene ID: 23761
• mRNA Refseq: NM_014338
• Protein Refseq: NP_055153
• MIM: 612770
• UniProt ID: Q9UG56
• Chromosome Location: 22q12.2
• Pathway: FOXA1 transcription factor network, organism-specific biosystem; Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem
• Function: lyase activity; phosphatidylserine decarboxylase activity