Recombinant Human PGF, StrepII-tagged

• Cat.No.: PGF-27H
• Product Overview: Purified, full-length human recombinant PGF protein (amino acids 19-221, 203 a.a.) with StrepII tag, produced in human cells.

Specification

• Description: This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.
• Source: Human cell line
• Species: Human
• Tag: StrepII
• Form: Lyophilized from 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• Molecular Mass: 22.8 kDa
• Protein length: 19-221, 203 a.a.
• AA Sequence: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLH CVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWG CALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR
• Endotoxin: <0.1 eu per per μg protein by lal
• Purity: >90% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month.

Gene Information

• Gene Name: PGF?placental growth factor [?Homo sapiens?(human) ]
• Official Symbol: PGF
• Synonyms: PGF; placental growth factor; PGFL; PLGF; PlGF-2; D12S1900; SHGC-10760; placental growth factor, vascular endothelial growth factor-related protein; placental growth factor-like; PlGF; factor-related protein
• Gene ID: 5228
• mRNA Refseq: NM_001207012
• Protein Refseq: NP_001193941
• MIM: 601121
• UniProt ID: P49763
• Chromosome Location: 14q24.3
• Pathway: PI3K-Akt signaling pathway; Rap1 signaling pathway; Signaling by VEGF
• Function: growth factor activity; heparin binding; protein binding; protein heterodimerization activity