Recombinant Human PGF, StrepII-tagged
Cat.No. : | PGF-27H |
Product Overview : | Purified, full-length human recombinant PGF protein (amino acids 19-221, 203 a.a.) with StrepII tag, produced in human cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 19-221, 203 a.a. |
Description : | This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene. |
Form : | Lyophilized from 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
Molecular Mass : | 22.8 kDa |
AA Sequence : | LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLH CVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWG CALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR |
Endotoxin : | <0.1 eu per per μg protein by lal |
Purity : | >90% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month. |
Gene Name | PGF?placental growth factor [?Homo sapiens?(human) ] |
Official Symbol | PGF |
Synonyms | PGF; placental growth factor; PGFL; PLGF; PlGF-2; D12S1900; SHGC-10760; placental growth factor, vascular endothelial growth factor-related protein; placental growth factor-like; PlGF; factor-related protein |
Gene ID | 5228 |
mRNA Refseq | NM_001207012 |
Protein Refseq | NP_001193941 |
MIM | 601121 |
UniProt ID | P49763 |
Chromosome Location | 14q24.3 |
Pathway | PI3K-Akt signaling pathway; Rap1 signaling pathway; Signaling by VEGF |
Function | growth factor activity; heparin binding; protein binding; protein heterodimerization activity |
◆ Recombinant Proteins | ||
PGF-381M | Active Recombinant Mouse PGF protein, His-tagged | +Inquiry |
Pgf-356M | Recombinant Mouse Placental Growth Factor | +Inquiry |
PGF-770H | Active Recombinant Human PGF protein, Fc-tagged | +Inquiry |
PGF-21HFL | Recombinant Full Length Human PGF Protein, C-His-tagged | +Inquiry |
PGF-3061H | Recombinant Human PGF protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGF-1118MCL | Recombinant Mouse PGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGF Products
Required fields are marked with *
My Review for All PGF Products
Required fields are marked with *
0
Inquiry Basket