Recombinant Human PGF protein

• Cat.No.: PGF-333H
• Product Overview: Recombinant Human PGF protein was expressed in Escherichia coli.

Specification

• Description: This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.
• Source: E.coli
• Species: Human
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 0.02 % Tween-20.
• Bio-activity: Fully biologically active when compared to standard. The biologically active as determined by its ability to chemoattract human monocytes using a concentration range of 5.0-50 ng/ml.
• Molecular Mass: Approximately 34.6 kDa, a disulfide-linked homodimer consisting of two 152 amino acid polypeptide chains.
• Protein length: 152
• AA Sequence: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
• Endotoxin: Less than 0.1 EU/μg of rHuPlGF-2 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: PGF
• Official Symbol: PGF
• Synonyms: PGF; placental growth factor; PGFL, placental growth factor, vascular endothelial growth factor related protein , placental growth factor like; placenta growth factor; D12S1900; PlGF; PLGF; PlGF 2; SHGC 10760; placental growth factor-like; placental growth factor, vascular endothelial growth factor-related protein; PGFL; PlGF-2; SHGC-10760
• Gene ID: 5228
• mRNA Refseq: NM_001207012
• Protein Refseq: NP_001193941
• MIM: 601121
• UniProt ID: P49763-3