Recombinant Human PFN2 protein(11-130 aa), N-SUMO & N-His-tagged

• Cat.No.: PFN2-2731H
• Product Overview: Recombinant Human PFN2 protein(P35080)(11-130 aa), fused with N-terminal SUMO tag and N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 11-130 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: LMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYS

Gene Information

• Gene Name: PFN2 profilin 2 [ Homo sapiens ]
• Official Symbol: PFN2
• Synonyms: PFN2; profilin 2; profilin-2; profilin II; PFL; D3S1319E
• Gene ID: 5217
• mRNA Refseq: NM_002628
• Protein Refseq: NP_002619
• MIM: 176590
• UniProt ID: P35080