Recombinant Human PFN2 protein(11-130 aa), N-MBP & C-His-tagged
Cat.No. : | PFN2-2729H |
Product Overview : | Recombinant Human PFN2 protein(P35080)(11-130 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&MBP |
Protein Length : | 11-130 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | LMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYS |
Gene Name | PFN2 profilin 2 [ Homo sapiens ] |
Official Symbol | PFN2 |
Synonyms | PFN2; profilin 2; profilin-2; profilin II; PFL; D3S1319E; |
Gene ID | 5217 |
mRNA Refseq | NM_002628 |
Protein Refseq | NP_002619 |
MIM | 176590 |
UniProt ID | P35080 |
◆ Recombinant Proteins | ||
PFN2-2731H | Recombinant Human PFN2 protein(11-130 aa), N-SUMO & N-His-tagged | +Inquiry |
PFN2-2729H | Recombinant Human PFN2 protein(11-130 aa), N-MBP & C-His-tagged | +Inquiry |
PFN2-2361H | Recombinant Human Profilin 2, His-tagged | +Inquiry |
PFN2-6656M | Recombinant Mouse PFN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PFN2-4057R | Recombinant Rat PFN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFN2-3267HCL | Recombinant Human PFN2 293 Cell Lysate | +Inquiry |
PFN2-3268HCL | Recombinant Human PFN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFN2 Products
Required fields are marked with *
My Review for All PFN2 Products
Required fields are marked with *
0
Inquiry Basket