Recombinant Human PFKFB1 protein, GST-tagged

• Cat.No.: PFKFB1-7832H
• Product Overview: Recombinant Human PFKFB1 protein(138-241 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 138-241 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: ERRSLILQFAKEHGYKVFFIESICNDPGIIAENIRQVKLGSPDYIDCDREKVLEDFLKRIECYEVNYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHIQSRTV
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: PFKFB1
• Synonyms: PFKFB1; F6PK; HL2K; PFRX; 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1; 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1; PFK/FBPase 1; 6PF-2-K/Fru-2,6-P2ase 1; 6PF-2-K/Fru-2,6-P2ASE liver isozyme; fructose-6-phosphate,2-kinase:fructose-2,6-bisphosphatase; EC 2.7.1.105; EC 3.1.3.46
• Gene ID: 5207
• mRNA Refseq: NM_001271804
• Protein Refseq: NP_001258733
• MIM: 311790
• UniProt ID: P16118