Recombinant Human PECR Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PECR-6171H
• Product Overview: PECR MS Standard C13 and N15-labeled recombinant protein (NP_060911) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Participates in chain elongation of fatty acids. Has no 2,4-dienoyl-CoA reductase activity.
• Molecular Mass: 32.5 kDa
• AA Sequence: MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PECR peroxisomal trans-2-enoyl-CoA reductase [ Homo sapiens (human) ]
• Official Symbol: PECR
• Synonyms: PECR; peroxisomal trans-2-enoyl-CoA reductase; HSA250303; SDR29C1; short chain dehydrogenase/reductase family 29C; member 1; TERP; DCR-RP; pVI-ARL; 2,4-dienoyl-CoA reductase-related protein; putative short chain alcohol dehydrogenase; short chain dehydrogenase/reductase family 29C, member 1; DCRRP; PVIARL; HPDHASE
• Gene ID: 55825
• mRNA Refseq: NM_018441
• Protein Refseq: NP_060911
• MIM: 605843
• UniProt ID: Q9BY49