Recombinant Full Length Human PECR Protein, C-Flag-tagged

• Cat.No.: PECR-56HFL
• Product Overview: Recombinant Full Length Human PECR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Participates in chain elongation of fatty acids. Has no 2,4-dienoyl-CoA reductase activity.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 32.4 kDa
• AA Sequence: MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTK QARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCK AVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAV ENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNW
  PKGAGDLSVVKKMKETFKEKAKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Protein Pathways: Biosynthesis of unsaturated fatty acids
• Full Length: Full L.

Gene Information

• Gene Name: PECR peroxisomal trans-2-enoyl-CoA reductase [ Homo sapiens (human) ]
• Official Symbol: PECR
• Synonyms: TERP; DCRRP; PVIARL; HPDHASE; SDR29C1; HSA250303
• Gene ID: 55825
• mRNA Refseq: NM_018441.6
• Protein Refseq: NP_060911.2
• MIM: 605843
• UniProt ID: Q9BY49