Recombinant Human PEBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PEBP1-2042H
• Product Overview: PEBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002558) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the phosphatidylethanolamine-binding family of proteins and has been shown to modulate multiple signaling pathways, including the MAP kinase (MAPK), NF-kappa B, and glycogen synthase kinase-3 (GSK-3) signaling pathways. The encoded protein can be further processed to form a smaller cleavage product, hippocampal cholinergic neurostimulating peptide (HCNP), which may be involved in neural development. This gene has been implicated in numerous human cancers and may act as a metastasis suppressor gene. Multiple pseudogenes of this gene have been identified in the genome.
• Molecular Mass: 21.1 kDa
• AA Sequence: MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PEBP1 phosphatidylethanolamine binding protein 1 [ Homo sapiens (human) ]
• Official Symbol: PEBP1
• Synonyms: PEBP1; phosphatidylethanolamine binding protein 1; PBP, prostatic binding protein; phosphatidylethanolamine-binding protein 1; HCNP; hippocampal cholinergic neurostimulating peptide; PEBP; Raf kinase inhibitory protein; RKIP; neuropolypeptide h3; prostatic binding protein; prostatic-binding protein; raf kinase inhibitor protein; PBP; HCNPpp; PEBP-1
• Gene ID: 5037
• mRNA Refseq: NM_002567
• Protein Refseq: NP_002558
• MIM: 604591
• UniProt ID: P30086