Recombinant Human PDS5B protein, GST-tagged

• Cat.No.: PDS5B-301643H
• Product Overview: Recombinant Human PDS5B (1139-1310 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1139-Thr1310
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MSSAGKQSQTKSSRMETVSNASSSSNPSSPGRIKGRLDSSEMDHSENEDYTMSSPLPGKKSDKRDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKT
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: PDS5B PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: PDS5B
• Synonyms: PDS5B; PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae); androgen induced proliferation inhibitor , APRIN; sister chromatid cohesion protein PDS5 homolog B; AS3; CG008; FLJ23236; KIAA0979; androgen-induced shutoff 3; androgen-induced proliferation inhibitor; androgen induced inhibitor of proliferation; androgen-induced prostate proliferative shutoff-associated protein AS3; APRIN
• Gene ID: 23047
• mRNA Refseq: NM_015032
• Protein Refseq: NP_055847
• MIM: 605333
• UniProt ID: Q9NTI5