Recombinant Human APRIN protein, GST-tagged

• Cat.No.: APRIN-728H
• Product Overview: Human APRIN partial ORF ( NP_055847, 1168 a.a. - 1259 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that interacts with the conserved protein complex termed cohesin. The cohesin complex holds together sister chromatids and facilitates accurate chromosome segregation during mitosis and meiosis. This protein is also a negative regulator of cell proliferation and may be a tumor-suppressor gene. [provided by RefSeq, Jul 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.86 kDa
• AA Sequence: GRIKGRLDSSEMDHSENEDYTMSSPLPGKKSDKRDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASES
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PDS5B PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: PDS5B
• Synonyms: PDS5B; PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae); androgen induced proliferation inhibitor , APRIN; sister chromatid cohesion protein PDS5 homolog B; AS3; CG008; FLJ23236; KIAA0979; androgen-induced shutoff 3; androgen-induced proliferation inhibitor; androgen induced inhibitor of proliferation; androgen-induced prostate proliferative shutoff-associated protein AS3; APRIN
• Gene ID: 23047
• mRNA Refseq: NM_015032
• Protein Refseq: NP_055847
• MIM: 605333
• UniProt ID: Q9NTI5