Recombinant Human PDGFA protein, GST-tagged

• Cat.No.: PDGFA-1608H
• Product Overview: Recombinant human PDGFA protein (135-196 aa) with a GST tag was expressed in E. coli.

Specification

• Description: This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit A, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit B. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes.
• Source: E. coli
• Species: Human
• Tag: GST
• Form: Powder
• AA Sequence: TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
  Short-term storage: Store at 2-8 centigrade for (1-2 weeks).
  Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Storage Buffer: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μL in 200 μL sterile water for short-term storage.
  Reconstitution with 200 μL 50% glycerol solution is recommended for longer term storage.
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
• Protein length: 135-196 a.a.

Gene Information

• Gene Name: PDGFA platelet derived growth factor subunit A [ Homo sapiens (human) ]
• Official Symbol: PDGFA
• Synonyms: PDGFA; platelet derived growth factor subunit A; PDGF1; PDGF-A; platelet-derived growth factor subunit A; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A-chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha polypeptide
• Gene ID: 5154
• mRNA Refseq: NM_002607
• Protein Refseq: NP_002598
• MIM: 173430
• UniProt ID: P04085