Recombinant Rat Pdgfa protein

• Cat.No.: Pdgfa-375R
• Product Overview: Recombinant Rat Pdgfa protein was expressed in E.coli.

Specification

• Description: Alpha chain of platelet derived growth factor; acts as a homodimer or heterodimer with PDGF beta to activate PDGF receptors.
• Source: E.coli
• Species: Rat
• Form: Lyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 5.0 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg.
• Molecular Mass: Approximately 25.3 kDa, a disulfide-linked homodimeric protein containing two 111 amino acid residues polypeptide (A chain).
• Protein length: 111
• AA Sequence: MSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETDVR
• Endotoxin: Less than 0.1 EU/μg of rRtPDGF-AA as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: Pdgfa
• Official Symbol: Pdgfa
• Synonyms: PDGFA; platelet-derived growth factor alpha polypeptide; platelet-derived growth factor subunit A; PDGF-1; PDGF subunit A; platelet derived growth factor, alpha; Platelet-derived growth factor A chain; PDGFACP
• Gene ID: 25266
• mRNA Refseq: NM_012801
• Protein Refseq: NP_036933
• UniProt ID: P28576