Recombinant Human PDGFA protein

Source :	E. coli
Species :	Human
Form :	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4
Protein length :	Ser87-Thr211
AA Sequence :	SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVK VAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Endotoxin :	Less than 0.1 ng/µg (1 IEU/µg).
Purity :	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage :	Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution :	Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping :	The product is shipped at ambient temperature.
Tag :	Non

Gene Name	PDGFA platelet-derived growth factor alpha polypeptide [ Homo sapiens ]
Official Symbol	PDGFA
Synonyms	PDGFA; platelet-derived growth factor alpha polypeptide; platelet-derived growth factor subunit A; PDGF A chain; PDGF A; PDGF1; platelet derived growth factor alpha chain; PDGF-1; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha isoform 2 preproprotein; PDGF-A;
Gene ID	5154
mRNA Refseq	NM_002607
Protein Refseq	NP_002598
MIM	173430
UniProt ID	P04085
Chromosome Location	7p22
Pathway	Ceramide signaling pathway, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Downstream signal transduction, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem;
Function	cell surface binding; collagen binding; eukaryotic cell surface binding; growth factor activity; platelet-derived growth factor binding; platelet-derived growth factor receptor binding; contributes_to platelet-derived growth factor receptor binding; platelet-derived growth factor receptor binding; protein heterodimerization activity; protein homodimerization activity;