Recombinant Human paxillin Protein, His-tagged

Cat.No. : PXN-001H
Product Overview : Recombinant human paxillin Protein (59-274 aa) with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 59-274aa
Description : This gene encodes a cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion). Alternatively spliced transcript variants encoding different isoforms have been described for this gene. These isoforms exhibit different expression pattern, and have different biochemical, as well as physiological properties.
Tag : C-His
Molecular Mass : 24 kDa
AA Sequence : MNGTILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSHHHHHHHH
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH 7.4
Concentration : 1 mg/mL by BCA
Gene Name PXN paxillin [ Homo sapiens (human) ]
Official Symbol PXN
Synonyms PXN; paxillin; FLJ16691;
Gene ID 5829
mRNA Refseq NM_001080855
Protein Refseq NP_001074324
MIM 602505
UniProt ID P49023

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PXN Products

Required fields are marked with *

My Review for All PXN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon