Recombinant Human PAX8

• Cat.No.: PAX8-29058TH
• Product Overview: Recombinant full length Human PAX8 with a proprietary tag: predicted molecular weight 75.24 kDa.

Specification

• Description: This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described.
• Protein length: 451 amino acids
• Molecular Weight: 75.240kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in the excretory system, thyroid gland and Wilms tumors.
• Biological activity: useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL
• Sequence Similarities: Contains 1 paired domain.
• Tag: Non

Gene Information

• Gene Name: PAX8 paired box 8 [ Homo sapiens ]
• Official Symbol: PAX8
• Synonyms: PAX8; paired box 8; paired box gene 8; paired box protein Pax-8
• Gene ID: 7849
• mRNA Refseq: NM_003466
• Protein Refseq: NP_003457
• MIM: 167415
• Uniprot ID: Q06710
• Chromosome Location: 2q13
• Pathway: Id Signaling Pathway, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Thyroid cancer, organism-specific biosystem; Thyroid cancer, conserved biosystem; Transcriptional misregulation in cancers, organism-specific biosystem
• Function: DNA binding; DNA binding; RNA polymerase II core promoter sequence-specific DNA binding; protein binding; sequence-specific DNA binding