Recombinant Full Length Human PAX8 Protein, C-Flag-tagged
Cat.No. : | PAX8-385HFL |
Product Overview : | Recombinant Full Length Human PAX8 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 48 kDa |
AA Sequence : | MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGS IRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF NLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSI DSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTP SNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAAS VYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP NSSLLSSPYYYSSTSRPSAPPTTATAFDHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | Pathways in cancer, Thyroid cancer |
Full Length : | Full L. |
Gene Name | PAX8 paired box 8 [ Homo sapiens (human) ] |
Official Symbol | PAX8 |
Synonyms | PAX-8 |
Gene ID | 7849 |
mRNA Refseq | NM_003466.4 |
Protein Refseq | NP_003457.1 |
MIM | 167415 |
UniProt ID | Q06710 |
◆ Recombinant Proteins | ||
PAX8-02H | Recombinant Human PAX8 Protein, C-Myc/DDK tagged | +Inquiry |
PAX8-451H | Recombinant Human PAX8 protein, His-tagged | +Inquiry |
PAX8-6665H | Recombinant Human PAX8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PAX8-2552H | Recombinant Human PAX8 Protein, His-tagged | +Inquiry |
PAX8-01H | Recombinant Human PAX8 Protein, C-Myc/DDK-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAX8-3412HCL | Recombinant Human PAX8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAX8 Products
Required fields are marked with *
My Review for All PAX8 Products
Required fields are marked with *
0
Inquiry Basket