Recombinant Full Length Human PAX8 Protein
Cat.No. : | PAX8-360HF |
Product Overview : | Recombinant full length Human PAX8 with a proprietary tag: predicted molecular weight 75.24 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 451 amino acids |
Description : | This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. |
Form : | Liquid |
Molecular Mass : | 75.240kDa inclusive of tags |
AA Sequence : | MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PAX8 paired box 8 [ Homo sapiens ] |
Official Symbol | PAX8 |
Synonyms | PAX8; paired box 8; Paired box gene 8; Paired box protein Pax-8 |
Gene ID | 7849 |
mRNA Refseq | NM_003466 |
Protein Refseq | NP_003457 |
MIM | 167415 |
UniProt ID | Q06710 |
◆ Recombinant Proteins | ||
Pax8-4687M | Recombinant Mouse Pax8 Protein, Myc/DDK-tagged | +Inquiry |
PAX8-4285R | Recombinant Rat PAX8 Protein | +Inquiry |
PAX8-12397M | Recombinant Mouse PAX8 Protein | +Inquiry |
PAX8-59H | Recombinant Human PAX8 Protein, C-His tagged | +Inquiry |
PAX8-675H | Recombinant Human paired box 8, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAX8-3412HCL | Recombinant Human PAX8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAX8 Products
Required fields are marked with *
My Review for All PAX8 Products
Required fields are marked with *
0
Inquiry Basket