Recombinant Human OVCA2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: OVCA2-831H
• Product Overview: OVCA2 MS Standard C13 and N15-labeled recombinant protein (NP_543012) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: OVCA2 (OVCA2 Serine Hydrolase Domain Containing) is a Protein Coding gene. Diseases associated with OVCA2 include Chromosome 17P13.3, Centromeric, Duplication Syndrome and Ovarian Cancer. Gene Ontology (GO) annotations related to this gene include hydrolase activity.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 24.4 kDa
• AA Sequence: MAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSDFGSCPPEEQPRGWWFSEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: OVCA2 ovarian tumor suppressor candidate 2 [ Homo sapiens (human) ]
• Official Symbol: OVCA2
• Synonyms: OVCA2; ovarian tumor suppressor candidate 2; ovarian cancer-associated gene 2 protein; candidate tumor suppressor in ovarian cancer 2; ovarian cancer gene-2 protein
• Gene ID: 124641
• mRNA Refseq: NM_080822
• Protein Refseq: NP_543012
• MIM: 607896
• UniProt ID: Q8WZ82