Recombinant Human OTOR Protein (111 aa)
Cat.No. : | OTOR-210O |
Product Overview : | Recombinant human Otoraplin (OTOR) produced in CHO cells is a single non-glycosylated polypeptide chain containing 111 amino acids. A fully biologically active molecule, rhOTOR has a molecular mass of 14-15 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Protein Length : | 111 |
Description : | OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the melanoma-inhibiting activity gene family. Members of this family which also includes MIA, MIA2, and TANGO share a SRC homology-3 (SH3)-like domain. OTOR appears to be involved in early chondrogenesis of the otic capsule, which is required for normal inner ear development and auditory function. OTOR is highly homologous to MIA/cartilage-derived retinoic acid-sensitive protein (CD-RAP), which is a cartilage-specific protein that is also expressed in malignant melanoma cells. The 111 amino acid mature human otoraplin contains 1 SH3 domain (46-107 amino acids) and a Tyr at position 50 that is reportedly sulfated. Otoraplin takes part in the initiation of periotic mesenchyme chondrogenesis. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Data Not Available. |
Molecular Mass : | 14-15 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant human Otoraplin (OTOR) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human Otoraplin (OTOR) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | OTOR otoraplin [ Homo sapiens ] |
Official Symbol | OTOR |
Synonyms | OTOR; otoraplin; FDP; MIAL; MIAL1; fibrocyte-derived protein; melanoma inhibitory activity-like protein; MGC126737; MGC126739; |
Gene ID | 56914 |
mRNA Refseq | NM_020157 |
Protein Refseq | NP_064542 |
MIM | 606067 |
UniProt ID | Q9NRC9 |
◆ Recombinant Proteins | ||
OTOR-22H | Recombinant Human Otoraplin | +Inquiry |
OTOR-4933H | Recombinant Human OTOR protein | +Inquiry |
OTOR-28850TH | Recombinant Human OTOR | +Inquiry |
Otor-4675M | Recombinant Mouse Otor protein, His-tagged | +Inquiry |
OTOR-6297C | Recombinant Chicken OTOR | +Inquiry |
◆ Cell & Tissue Lysates | ||
OTOR-3518HCL | Recombinant Human OTOR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OTOR Products
Required fields are marked with *
My Review for All OTOR Products
Required fields are marked with *
0
Inquiry Basket