Recombinant Human OTOR Protein (112 aa)
Cat.No. : | OTOR-063O |
Product Overview : | Recombinant Human OTOR Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 112 |
Description : | OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the MIA/OTOR family. Members of this family which also includes MIA, MIA2, and TANGO share a Src homology-3 (SH3)-like domain. OTOR is predominantly expressed in the cochlea of the inner-ear and to a lesser extent in fetal brain and in some cartilage tissues. OTOR appears to be involved in early chondrogenesis of the otic capsule, which is required for normal inner ear development and auditory function. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Data Not Available. |
Molecular Mass : | 12.7 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids. |
AA Sequence : | MVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE |
Endotoxin : | Less than 1 EU/μg of rHuOTOR as determined by LAL method. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | OTOR otoraplin [ Homo sapiens ] |
Official Symbol | OTOR |
Synonyms | OTOR; otoraplin; FDP; MIAL; MIAL1; fibrocyte-derived protein; melanoma inhibitory activity-like protein; MGC126737; MGC126739; |
Gene ID | 56914 |
mRNA Refseq | NM_020157 |
Protein Refseq | NP_064542 |
MIM | 606067 |
UniProt ID | Q9NRC9 |
◆ Recombinant Proteins | ||
OTOR-210O | Recombinant Human OTOR Protein (111 aa) | +Inquiry |
OTOR-28850TH | Recombinant Human OTOR | +Inquiry |
OTOR-5210H | Recombinant Human OTOR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Otor-8009M | Recombinant Mouse Otor protein, His & T7-tagged | +Inquiry |
OTOR-22H | Recombinant Human Otoraplin | +Inquiry |
◆ Cell & Tissue Lysates | ||
OTOR-3518HCL | Recombinant Human OTOR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OTOR Products
Required fields are marked with *
My Review for All OTOR Products
Required fields are marked with *
0
Inquiry Basket