Recombinant Human OTOR Protein (112 aa)

• Cat.No.: OTOR-318O
• Product Overview: Recombinant human Otoraplin (rhOTOR) produced in E. coli is a single non-glycosylated polypeptide chain containing 112 amino acids. rhOTOR has a molecular mass of 12.7 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 112
• Description: Otoraplin (OTOR) is a cytokine first identified in 2000 and encodes a small protein of 128 amino acids with an SH3 domain. OTOR is a homologue to CD-RAP/MIA and contains a hydrophobic N-terminal region as a signal peptide, which indicates that OTOR is mainly secreted. Researchers found that high expression of OTOR is only seen in the cochlea, demonstrating its importance in hearing. Indeed, loss of the gene produces cochlear dysfunction and otosclerosis, a hearing disorder involving the bony tissue of the ear. OTOR exerts an influence on the surrounding otic capsule and functions in the extracellular matrix of the membranous portion of the cochlea.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Data not available.
• Molecular Mass: 12.7 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Storage: Lyophilized recombinant human Otoraplin (rhOTOR) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhOTOR remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: OTOR otoraplin [ Homo sapiens ]
• Official Symbol: OTOR
• Synonyms: OTOR; otoraplin; FDP; MIAL; MIAL1; fibrocyte-derived protein; melanoma inhibitory activity-like protein; MGC126737; MGC126739
• Gene ID: 56914
• mRNA Refseq: NM_020157
• Protein Refseq: NP_064542
• MIM: 606067
• UniProt ID: Q9NRC9