Recombinant Human OSCAR Protein, His-tagged

Cat.No. : OSCAR-002H
Product Overview : Recombinant Human OSCAR Protein, His-tagged,expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : HEK293
Species : Human
Tag : C-His
Protein length : 19-229 aa
Molecular Mass : 24 kDa
AA Sequence : DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMNFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEDSGSSDYTRGNHHHHHHHH
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1mg/ml by BCA
Storage Buffer : Sterile PBS, pH 7.4
GeneID : 126014
Gene Name OSCAR osteoclast associated Ig-like receptor [ Homo sapiens (human) ]
Official Symbol OSCAR
Synonyms PIGR3,PIgR-3,OSCAR
MIM 606862
UniProt ID Q8IYS5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All OSCAR Products

Required fields are marked with *

My Review for All OSCAR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon