Recombinant Human OSCAR Protein, His-tagged
Cat.No. : | OSCAR-002H |
Product Overview : | Recombinant Human OSCAR Protein, His-tagged,expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Source : | HEK293 |
Species : | Human |
Tag : | C-His |
Protein length : | 19-229 aa |
Molecular Mass : | 24 kDa |
AA Sequence : | DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMNFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEDSGSSDYTRGNHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH 7.4 |
GeneID : | 126014 |
Gene Name | OSCAR osteoclast associated Ig-like receptor [ Homo sapiens (human) ] |
Official Symbol | OSCAR |
Synonyms | PIGR3,PIgR-3,OSCAR |
MIM | 606862 |
UniProt ID | Q8IYS5 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OSCAR Products
Required fields are marked with *
My Review for All OSCAR Products
Required fields are marked with *
0
Inquiry Basket