Recombinant Human OSCAR Protein, His-tagged
Cat.No. : | OSCAR-002H |
Product Overview : | Recombinant Human OSCAR Protein, His-tagged,expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 19-229 aa |
Tag : | C-His |
Molecular Mass : | 24 kDa |
AA Sequence : | DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMNFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEDSGSSDYTRGNHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH 7.4 |
GeneID : | 126014 |
Gene Name | OSCAR osteoclast associated Ig-like receptor [ Homo sapiens (human) ] |
Official Symbol | OSCAR |
Synonyms | PIGR3,PIgR-3,OSCAR |
MIM | 606862 |
UniProt ID | Q8IYS5 |
◆ Recombinant Proteins | ||
OSCAR-12207M | Recombinant Mouse OSCAR Protein | +Inquiry |
OSCAR-7618H | Recombinant Human OSCAR, His-tagged | +Inquiry |
OSCAR-2829H | Recombinant Human OSCAR Protein, His-tagged, OVA Conjugated | +Inquiry |
OSCAR-002H | Recombinant Human OSCAR Protein, His-tagged | +Inquiry |
OSCAR-1925H | Active Recombinant Human OSCAR protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSCAR-3527HCL | Recombinant Human OSCAR 293 Cell Lysate | +Inquiry |
OSCAR-3528HCL | Recombinant Human OSCAR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OSCAR Products
Required fields are marked with *
My Review for All OSCAR Products
Required fields are marked with *
0
Inquiry Basket