Recombinant Human NUDT3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NUDT3-3144H
• Product Overview: NUDT3 MS Standard C13 and N15-labeled recombinant protein (NP_006694) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions.
• Molecular Mass: 19.3 kDa
• AA Sequence: MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NUDT3 nudix hydrolase 3 [ Homo sapiens (human) ]
• Official Symbol: NUDT3
• Synonyms: NUDT3; nudix (nucleoside diphosphate linked moiety X)-type motif 3; diphosphoinositol polyphosphate phosphohydrolase 1; DIPP; nudix motif 3; nucleoside diphosphate-linked moiety X motif 3; diadenosine 5,5-P1,P6-hexaphosphate hydrolase 1; DIPP1; DIPP-1
• Gene ID: 11165
• mRNA Refseq: NM_006703
• Protein Refseq: NP_006694
• MIM: 609228
• UniProt ID: O95989