Recombinant Human NUDT21, His-tagged

• Cat.No.: NUDT21-27532TH
• Product Overview: Recombinant full length Human NUDT21 with an N terminal His tag; 247aa, 28.3kDa inclusive of tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 227 amino acids
• Description: The protein encoded by this gene is one subunit of a cleavage factor required for 3 RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3 end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.
• Conjugation: HIS
• Molecular Weight: 28.300kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
• Sequence Similarities: Belongs to the Nudix hydrolase family. CPSF5 subfamily.Contains 1 nudix hydrolase domain.

Gene Information

• Gene Name: NUDT21 nudix (nucleoside diphosphate linked moiety X)-type motif 21 [ Homo sapiens ]
• Official Symbol: NUDT21
• Synonyms: NUDT21; nudix (nucleoside diphosphate linked moiety X)-type motif 21; cleavage and polyadenylation specific factor 5, 25 kD subunit , cleavage and polyadenylation specific factor 5, 25 kDa , CPSF5; cleavage and polyadenylation specificity factor subunit
• Gene ID: 11051
• mRNA Refseq: NM_007006
• Protein Refseq: NP_008937
• MIM: 604978
• Uniprot ID: O43809
• Chromosome Location: 16q12.2
• Pathway: Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Processing of Capped Intronless Pre-mRNA, organism-specific biosystem
• Function: AU-rich element binding; contributes_to RNA binding; histone deacetylase binding; hydrolase activity; mRNA binding