Recombinant Full Length Human NUDT21 Protein, GST-tagged

Cat.No. : NUDT21-2211HF
Product Overview : Human CPSF5 full-length ORF ( AAH01403, 1 a.a. - 227 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 227 amino acids
Description : The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. [provided by RefSeq, Jul 2008]
Molecular Mass : 50.71 kDa
AA Sequence : MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NUDT21 nudix (nucleoside diphosphate linked moiety X)-type motif 21 [ Homo sapiens ]
Official Symbol NUDT21
Synonyms NUDT21; nudix (nucleoside diphosphate linked moiety X)-type motif 21; cleavage and polyadenylation specific factor 5, 25 kD subunit , cleavage and polyadenylation specific factor 5, 25 kDa , CPSF5; cleavage and polyadenylation specificity factor subunit 5; CFIM25; nudix motif 21; CPSF 25 kDa subunit; pre-mRNA cleavage factor Im (25kD); pre-mRNA cleavage factor Im, 25kD subunit; pre-mRNA cleavage factor Im 25 kDa subunit; nucleoside diphosphate-linked moiety X motif 21; cleavage and polyadenylation specific factor 5, 25 kDa; cleavage and polyadenylation specific factor 5, 25 kD subunit; cleavage and polyadenylation specificity factor 25 kDa subunit; CPSF5; DKFZp686H1588
Gene ID 11051
mRNA Refseq NM_007006
Protein Refseq NP_008937
MIM 604978
UniProt ID O43809

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NUDT21 Products

Required fields are marked with *

My Review for All NUDT21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon