Recombinant Human NTF3, StrepII-tagged

• Cat.No.: NTF3-16H
• Product Overview: Recombinant full-length Human NTF3 (Accession NP_002518.1; UniProt P20783) protein (amino acids 19-257, 239 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 27.3 kDa.

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 19-257, 239 a.a.
• Description: NTF3 is a member of the neurotrophin family, that controls survival and differentiation of mammalian neurons. This protein is closely related to both nerve growth factor (NGF) and brain-derived neurotrophic factor (BDNF). It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: NNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELL RQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDI RGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRID TSCVCALSRKIGRT
• Endotoxin: <0.1 EU per ug protein by LAL method
• Purity: >80% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4¡ãC after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: NTF3 neurotrophin 3 [ Homo sapiens (human) ]
• Official Symbol: NTF3
• Synonyms: NT3; HDNF; NGF2; NT-3; NGF-2; neurotrophin-3; neurotrophic factor; nerve growth factor 2
• Gene ID: 4908
• mRNA Refseq: NM_002527
• Protein Refseq: NP_002518
• MIM: 162660
• UniProt ID: P20783
• Chromosome Location: 12p13
• Pathway: BDNF signaling pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; Neurotrophic factor-mediated Trk receptor signaling, organism-specific biosystem
• Function: chemoattractant activity; growth factor activity; nerve growth factor binding