Recombinant Human/Mouse NTF3 Protein
Cat.No. : | NTF3-217H |
Product Overview : | Recombinant Human/Mouse NTF3 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human/Mouse |
Source : | E.coli |
Description : | Neurotrophin-3 (NT-3) is an important member of the nerve growth factor (NGF) family of proteins. NT-3 promotes the growth, survival, and differentiation of neurons and synapses in the peripheral and central nervous systems. The receptor tyrosine kinase TrkC exclusively binds in high-affinity to NT-3. NT-3 also signals through the receptor tyrosine kinase TrkB, and through the low affinity nerve growth factor receptor (LNGFR). |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Dimer (Noncovalently linked), 13.8/27.5 kDa (120/240 aa) |
AA Sequence : | MYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | NTF3 neurotrophin 3 [ Homo sapiens (human) ] |
Official Symbol | NTF3 |
Synonyms | NTF3; neurotrophin 3; neurotrophin-3; NGF2; NT-3; neurotrophic factor; nerve growth factor 2; NT3; HDNF; NGF-2; MGC129711; |
Gene ID | 4908 |
mRNA Refseq | NM_001102654 |
Protein Refseq | NP_001096124 |
MIM | 162660 |
UniProt ID | P20783 |
◆ Recombinant Proteins | ||
NTF3-011H | Active Recombinant Human NTF3(139-257aa) | +Inquiry |
NTF3-10933M | Recombinant Mouse NTF3 Protein | +Inquiry |
NTF3-3621H | Recombinant Human Neurotrophin 3 | +Inquiry |
Ntf3-1868M | Recombinant Mouse Ntf3 Protein, His-tagged | +Inquiry |
NTF3-128H | Recombinant Human 3 -Nucleotidase | +Inquiry |
◆ Native Proteins | ||
NTF3-29249TH | Native Human NTF3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NTF3-3671HCL | Recombinant Human NTF3 293 Cell Lysate | +Inquiry |
NTF3-3670HCL | Recombinant Human NTF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NTF3 Products
Required fields are marked with *
My Review for All NTF3 Products
Required fields are marked with *
0
Inquiry Basket