| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
32 |
| Description : |
Brain Natriuretic Peptide is encoded by the BNP gene located on the Chr.1 in humans. It is firstly discovered in the porcine brain and given this name, but the protein is mainly expressed in the cardiac ventricles in human body after the excessive stretching of cardiomyocytes. The gene expresses a 134 a.a. sequence which contains a 1-26 a.a. signal peptide and 27-134 a.a. Natriuretic peptides B, and the BNP is the 32 a.a. C-terminus of natriuretic peptides B. The BNP can be cleaved in 16 chains and the rHuBNP is 1-32. BNP acts as a cardiac hormone with a variety of functions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Additionnaly, it plays a key role in cardiovascular homeostasis, helps restore the body's salt and water balance and improves heart function. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Molecular Mass : |
Approximately 3.5 kDa, a single non-glycosylated polypeptide chain containing 32 amino acids. |
| AA Sequence : |
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Endotoxin : |
Less than 1 EU/μg of rHuBNP as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
