Recombinant Human NOX4 Protein, GST-tagged

Cat.No. : NOX4-6008H
Product Overview : Human NOX4 partial ORF ( NP_058627.1, 479 a.a. - 578 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants
Molecular Mass : 36.74 kDa
AA Sequence : LHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NOX4 NADPH oxidase 4 [ Homo sapiens ]
Official Symbol NOX4
Synonyms NOX4; NADPH oxidase 4; KOX; KOX 1; kidney oxidase-1; renal NAD(P)H-oxidase; kidney superoxide-producing NADPH oxidase; KOX-1; RENOX;
Gene ID 50507
mRNA Refseq NM_001143836
Protein Refseq NP_001137308
MIM 605261
UniProt ID Q9NPH5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NOX4 Products

Required fields are marked with *

My Review for All NOX4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon