Recombinant Rat NOX4 Protein (210-424 aa), His-tagged

• Cat.No.: NOX4-1475R
• Product Overview: Recombinant Rat NOX4 Protein (210-424 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Description: Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB.
• Source: Yeast
• Species: Rat
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 40.6 kDa
• Protein length: 210-424 aa
• AA Sequence: GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Nox4 NADPH oxidase 4 [ Rattus norvegicus ]
• Official Symbol: NOX4
• Synonyms: NOX4; NADPH oxidase 4; kox-1; kidney oxidase-1
• Gene ID: 85431
• mRNA Refseq: NM_053524
• Protein Refseq: NP_445976
• UniProt ID: Q924V1