Recombinant Human NOX1 Full Length Transmembrane protein, His-tagged

• Cat.No.: NOX1-1329H
• Product Overview: Recombinant Human NOX1 protein(Q9Y5S8)(1-564aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-564aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 67.7 kDa
• AA Sequence: MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: NOX1 NADPH oxidase 1 [ Homo sapiens ]
• Official Symbol: NOX1
• Synonyms: NOX1; NADPH oxidase 1; GP91 2; mitogenic oxidase (pyridine nucleotide dependent superoxide generating); MOX1; NADPH oxidase 1 variant NOH 1L; NADPH oxidase homolog 1; NOH 1; NOH1; MOX-1; NOX-1; mitogenic oxidase 1; NADPH oxidase homolog-1; NADPH oxidase 1 variant NOH-1L; NADH/NADPH mitogenic oxidase subunit P65-MOX; mitogenic oxidase (pyridine nucleotide-dependent superoxide-generating); NOH-1; GP91-2
• Gene ID: 27035
• mRNA Refseq: NM_007052
• Protein Refseq: NP_008983
• MIM: 300225
• UniProt ID: Q9Y5S8