Recombinant Human NOP10 Protein, GST-tagged

Cat.No. : NOP10-5981H
Product Overview : Human NOLA3 partial ORF ( NP_061118.1, 1 a.a. - 64 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA1 and NOLA2 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. The four H/ACA snoRNP proteins are also components of the telomerase complex. This gene encodes a protein related to Saccharomyces cerevisiae Nop10p. [provided by RefSeq
Molecular Mass : 32.78 kDa
AA Sequence : MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NOP10 NOP10 ribonucleoprotein [ Homo sapiens (human) ]
Official Symbol NOP10
Synonyms NOP10; DKCB1; NOLA3; NOP10P; NOP10 ribonucleoprotein; H/ACA ribonucleoprotein complex subunit 3; nucleolar protein 10; snoRNP protein NOP10; homolog of yeast Nop10p; NOP10 ribonucleoprotein homolog; nucleolar protein family A member 3; nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs)
Gene ID 55505
mRNA Refseq NM_018648
Protein Refseq NP_061118
MIM 606471
UniProt ID Q9NPE3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NOP10 Products

Required fields are marked with *

My Review for All NOP10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon